Newcastle City Farmers Market
- Delivery Location
- Raw Goat Milk
- Goat Milk is A2
- A2 Protein
- Websitenewcastlecityfarmersmarket.com.au
- Contact info
- Location- Griffiths Rd
 Broadmeadow, New South Wales
 Australia 2292
- Open in Google Maps(experimental)
 
Description:
Where their raw milk comes from
Keep this project running
Select a tip amount
Please enter a valid email address to generate a secure payment form.

GetRawMilk.com is crowdsourced.
Free, no paywalls or subscriptions.
Keep this project going and growing.
Development services for web and mobile apps. Information Technology infrastructure for your business or startup. Start the ball rolling with your own platform.
Get noticed by raw milk seekers in the US and abroad on the global raw milk map.
Swipe right on some shirts
Find raw milk by species
Follow farms on social media
Other ways to find raw milk
- Search by location
- Raw Milk Global Map
- 3D Global Sphere
- Use device location
- RAWMI
- Raw Milk Law Map








